Platelet Factor 4 human recombinant
Properties
| Product # | Platelet Factor 4 human recombinant (PF4-hr) |
| Species | human |
| Source | Escherichia coli |
| Mol wt | 7.8 kDa (monomer) |
| UniProt # | P02776 |
| Purity | > 95% (SDS-PAGE) |
| AA sequence | MEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCP TAQLIATLKNGRKICLDLQAPLYKKIIKKLLES |
| Product sizes | 100 µg, 200 µg, 1 mg (different sizes are available on request) |
| Quality control | PF4/Heparin-ELISA (HIT-Test)*, SDS-PAGE, Western Blot, N-terminal sequencing and MALDI-TOF-MS |
| Physical form | Lyophilized in PBS (0.22 µm filtered), carrier free (different buffers are available on request) |
| Reconstitution | Reconstitute carefully in A. dest. (1 µl/µg PF4). Adjust the protein concentration with PBS. Do not vortex. |
| Shipping | Ambient temperature |
| Storage | Store dark in working aliquots at -20°C to -80°C. Avoid repeated freezing and thawing. |
| Stability | Lyophilisate is stable for at least 12 month. |
Description
Platelet Factor 4 (PF4; also known as CXCL4) is synthesized in megakaryocytes and platelets. The monomer of the chemokine consists of 70 amino acids resulting in a molecular weight of 7.8 kDa. Depending on the protein concentration and buffer conditions, PF4 appears as a mono-, di-, tri-, or tetramer. PF4 is biologically active in the tetrameric form, promotes blood coagulation and is also important in wound healing and inflammation. PF4, together with heparin (PF4-heparin complex) is an important antigen of antibodies inducing heparin-induced thrombocytopenia (HIT). Purified PF4 is used in several laboratory tests for the detection of HIT antibodies.
*The production of PF4 and its quality control is performed in collaboration with the Institute of Immunology and Transfusion Medicine, Department of Transfusion Medicine of the University Medicine Greifswald.
Publications referencing this product:
- Blanchet X, Cesarek K, Brandt J, et al. Inflammatory role and prognostic value of platelet chemokines in acute coronary syndrome. Thromb Haemost. 2014;112(6):1277–87. – Supplementary Material
http://th.schattauer.de/en/contents/archive/issue/2155/manuscript/22391.html
