Platelet Factor 4 Variant 1 human recombinant
Properties
| Product # | Platelet Factor 4 Variant 1 human recombinant (PF4-V1-hr) |
| Species | human |
| Source | Escherichia coli |
| Mol wt | 8.7 kDa (monomer, including 6 x His tag) |
| UniProt # | P10720 |
| Purity | > 95% (SDS-PAGE) |
| AA sequence | MHHHHHHEAEEDGDLQCLCVKTTSQVRPRHITSLEV IKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES |
| Product sizes | 50 µg, 100 µg, 200 µg (different sizes are available on request) |
| Quality control | SDS-PAGE, Western Blot, N-terminal sequencing and MALDI-TOF-MS |
| Physical form | Lyophilized in PBS (0.22 µm filtered), carrier free (different buffers are available on request) |
| Reconstitution | Reconstitute carefully in A. dest. (1 µl/µg PF4). Adjust the protein concentration with PBS. Do not vortex. |
| Shipping | Ambient temperature |
| Storage | Store dark in working aliquots at -20°C to -80°C. Avoid repeated freezing and thawing. |
| Stability | Lyophilisate is stable for at least 12 month. |
Description
Platelet Factor 4 (PF4; also known as CXCL4) is synthesized in megakaryocytes and platelets. The mature protein of PF4 Variant 1 (PF4-V1 or CXCL4L1) differs from authentic PF4 only in three carboxy-terminal amino acids. PF4-V1 was shown to exhibit different properties and cellular functions compared to PF4, as well as a different subcellular distribution (38 % difference in the amino acid sequence of the signal peptide). PF4-V1-hr (ChromaTec GmbH) is produced recombinantly in E. coli and is affinity purified via an N-terminal 6 x His-tag. The monomer of PF4-V1-hr including the 6 x His-tag has a molecular weight of 8.7 kDa.
Publications referencing this product:
- Blanchet X, Cesarek K, Brandt J, et al. Inflammatory role and prognostic value of platelet chemokines in acute coronary syndrome. Thromb Haemost. 2014;112(6):1277–87. – Supplementary Material
http://th.schattauer.de/en/contents/archive/issue/2155/manuscript/22391.html
