Platelet Factor 4 Mouse recombinant
Properties
| Product # | Platelet Factor 4 Mouse recombinant (PF4-mr) |
| Species | Mouse (murine) |
| Source | Escherichia coli |
| Mol wt | 8.0 kDa (monomer) |
| UniProt # | Q9Z126 |
| Purity | > 95% (SDS-PAGE) |
| AA sequence | MGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGR HCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES |
| Product sizes | 50 µg, 100 µg, 200 µg (different sizes are available on request) |
| Quality control | SDS-PAGE, Western Blot, N-terminal sequencing and MALDI-TOF-MS |
| Physical form | Lyophilized in PBS (0.22 µm filtered), carrier free (different buffers are available on request) |
| Reconstitution | Reconstitute carefully in A. dest. (1 µl/µg PF4). Adjust the protein concentration with PBS. Do not vortex. |
| Shipping | Ambient temperature |
| Storage | Store dark in working aliquots at -20°C to -80°C. |
| Stability | Avoid repeated freezing and thawing. Lyophilisate is stable for at least 12 month. |
Description
Platelet Factor 4 (PF4; also known as CXCL4) is synthetized in megakaryocytes and platelets. PF4 is biologically active in the tetrameric form, promotes blood coagulation and is also important in wound healing and inflammation. PF4, together with heparin (PF4-heparin complex) is an important antigen of antibodies inducing heparin-induced thrombocytopenia (HIT) in humans. Mouse (murine) PF4 shares 64% sequence identity with human PF4.
Publications referencing this product:
- Schulze A, Jensch I, Krauel K, et al. New insights in heparin-induced thrombocytopenia by the use of fluid-phase assays to detect specifically platelet factor 4/heparin complex antibodies and antibody-secreting cells. Thrombosis research. 2014;134(1):174–81.
http://www.sciencedirect.com/science/article/pii/S004938481400228X - Jaax ME, Krauel K, Marschall T, et al. Complex formation with nucleic acids and aptamers alters the antigenic properties of platelet factor 4. Blood. 2013;122(2):272–81.
http://www.bloodjournal.org/content/122/2/272.long - Krauel K, Pӧtschke C, Weber C, et al. Platelet factor 4 binds to bacteria, inducing antibodies cross-reacting with the major antigen in heparin-induced thrombocytopenia. Blood. 2011;117(4):1370–8.
http://www.bloodjournal.org/content/117/4/1370.long?sso-checked=true

