Platelet Factor 4 Mouse recombinant

Properties

Product # Platelet Factor 4 Mouse recombinant (PF4-mr)
Species Mouse (murine)
Source Escherichia coli
Mol wt 8.0 kDa (monomer)
UniProt # Q9Z126
Purity > 95% (SDS-PAGE)
AA sequence MGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGR
HCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Product sizes 50 µg, 100 µg, 200 µg (different sizes are available on request)
Quality control SDS-PAGE, Western Blot, N-terminal sequencing and MALDI-TOF-MS
Physical form Lyophilized in PBS (0.22 µm filtered), carrier free
(different buffers are available on request)
Reconstitution Reconstitute carefully in A. dest. (1 µl/µg PF4).
Adjust the protein concentration with PBS. Do not vortex.
Shipping Ambient temperature
Storage Store dark in working aliquots at -20°C to -80°C.
Stability Avoid repeated freezing and thawing.
Lyophilisate is stable for at least 12 month.

Description

Platelet Factor 4 (PF4; also known as CXCL4) is synthetized in megakaryocytes and platelets. PF4 is biologically active in the tetrameric form, promotes blood coagulation and is also important in wound healing and inflammation. PF4, together with heparin (PF4-heparin complex) is an important antigen of antibodies inducing heparin-induced thrombocytopenia (HIT) in humans. Mouse (murine) PF4 shares 64% sequence identity with human PF4.

Publications referencing this product:

List of prices:  


Request to: info[at]chromatec.de


Datasheet:  

SDS-Page
Western Blot